PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00024515-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family BBR-BPC
Protein Properties Length: 293aa    MW: 32792.5 Da    PI: 8.6676
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00024515-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind315.61.6e-96129329301
              GAGA_bind  29 mssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla....salpvgvqvlsgtksidslq 112
                            m++ aerda+irern+al e+k a++erdma l+rd+a+aern a+ erd+++++l ++e s++      +++g +  sg k i + q
  SMil_00024515-RA_Salv   1 MAITAERDAAIRERNMALEERKRAFQERDMAMLERDAAIAERNTAMQERDEAIASLRYRESSMNdntnIPDSFGNELASGGKRIIQYQ 88 
                            78899********************************************************99987544556788999******9999 PP

              GAGA_bind 113 qlsepqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader............. 186
                            q+++ +++d a+  + + + ++   i  a++ ++ k+++ ++ + k+ k++k+ k+ + ++ + + v ke+++++             
  SMil_00024515-RA_Salv  89 QQQQMRVSDAAYSpKGNLRGND---IGIAETAETAKPRRGRQTKDKEGKATKSAKPPRAGKRTAEAVIKEEVNSDayngwsneqgles 173
                            9999999999998444443333...3333333333333333444455555555555555555555555555443345678899***** PP

              GAGA_bind 187 ......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkkl 268
                                  ++ ++k  +l+ln++++Des++PvPvCsCtG+++ CY+WGnGGWqSaCCtttiS+yPLP+++++r +R++grKmS++af+kl
  SMil_00024515-RA_Salv 174 deeyldKQVSWK-DNLGLNQINFDESAMPVPVCSCTGSPQPCYRWGNGGWQSACCTTTISMYPLPQVANKRYSRVGGRKMSGSAFNKL 260
                            ****95555555.69************************************************************************* PP

              GAGA_bind 269 LekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                            L++LaaeGyd+s p+DLkdhWAkHGtn++ t++
  SMil_00024515-RA_Salv 261 LNRLAAEGYDFSSPLDLKDHWAKHGTNRYSTLK 293
                            *****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.5E-841293IPR010409GAGA-binding transcriptional activator
SMARTSM012266.2E-961293IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MAITAERDAA IRERNMALEE RKRAFQERDM AMLERDAAIA ERNTAMQERD EAIASLRYRE  60
SSMNDNTNIP DSFGNELASG GKRIIQYQQQ QQMRVSDAAY SPKGNLRGND IGIAETAETA  120
KPRRGRQTKD KEGKATKSAK PPRAGKRTAE AVIKEEVNSD AYNGWSNEQG LESDEEYLDK  180
QVSWKDNLGL NQINFDESAM PVPVCSCTGS PQPCYRWGNG GWQSACCTTT ISMYPLPQVA  240
NKRYSRVGGR KMSGSAFNKL LNRLAAEGYD FSSPLDLKDH WAKHGTNRYS TLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099810.11e-171PREDICTED: protein BASIC PENTACYSTEINE6-like
RefseqXP_011099811.11e-171PREDICTED: protein BASIC PENTACYSTEINE6-like
SwissprotQ8L9995e-87BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A022PVV91e-145A0A022PVV9_ERYGU; Uncharacterized protein
STRINGSolyc02g084230.1.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA80622230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.24e-88basic pentacysteine 6